PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0846s0080.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 337aa    MW: 37812.7 Da    PI: 5.2296
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0846s0080.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.61.2e-5361331128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                             lppGfrFhPtdeelv +yL++kveg ++el evi+ +d+yk++Pw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat++gyWka
  SapurV1A.0846s0080.1.p   6 LPPGFRFHPTDEELVGYYLQRKVEGLEIEL-EVIPVIDLYKFDPWELPeKsFLPKRDMEWFFFCPRDRKYPNGSRTNRATHAGYWKA 91 
                             79****************************.99**************95344555788***************************** PP

                     NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             tgkd++v++ +++++  +ktLvfy+grap+g +tdWvmheyrl
  SapurV1A.0846s0080.1.p  92 TGKDRKVVC-QSAVTAYRKTLVFYRGRAPSGDRTDWVMHEYRL 133
                             *********.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-614156IPR003441NAC domain
PROSITE profilePS5100557.4966156IPR003441NAC domain
PfamPF023651.3E-287133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGGASLPPGF RFHPTDEELV GYYLQRKVEG LEIELEVIPV IDLYKFDPWE LPEKSFLPKR  60
DMEWFFFCPR DRKYPNGSRT NRATHAGYWK ATGKDRKVVC QSAVTAYRKT LVFYRGRAPS  120
GDRTDWVMHE YRLSDGLSQG SPNFKGAFAL CRVVKKNEQG LKMSDPQGEP RTKKDGSSSS  180
NVDFTSNVVS NEPSNISSEI SSQASYLYSN GNQYSTPIAS PYQVTTMSGF EPAASLESNP  240
SSHWISPELI LDSSKDYPQV HEAASQYFPQ YEYPSSMNTW QPDTHGEFSP GSSYSNLTGE  300
IEPADDLSHI GFMSPYSEHG NYMGFGGNDD MHYQGY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-52516216171NO APICAL MERISTEM PROTEIN
1ut4_B4e-52516216171NO APICAL MERISTEM PROTEIN
1ut7_A4e-52516216171NO APICAL MERISTEM PROTEIN
1ut7_B4e-52516216171NO APICAL MERISTEM PROTEIN
3swm_A5e-52516219174NAC domain-containing protein 19
3swm_B5e-52516219174NAC domain-containing protein 19
3swm_C5e-52516219174NAC domain-containing protein 19
3swm_D5e-52516219174NAC domain-containing protein 19
3swp_A5e-52516219174NAC domain-containing protein 19
3swp_B5e-52516219174NAC domain-containing protein 19
3swp_C5e-52516219174NAC domain-containing protein 19
3swp_D5e-52516219174NAC domain-containing protein 19
4dul_A4e-52516216171NAC domain-containing protein 19
4dul_B4e-52516216171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7753233e-43KC775323.1 Jatropha curcas NAC transcription factor 045 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011028211.10.0PREDICTED: NAC domain-containing protein 86
RefseqXP_011028212.10.0PREDICTED: NAC domain-containing protein 86
TrEMBLB9N2P70.0B9N2P7_POPTR; Uncharacterized protein
STRINGPOPTR_0003s08830.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67223450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-108NAC domain containing protein 71